Placeholder image of a protein
Icon representing a puzzle

2221: Electron Density Reconstruction 15

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
November 01, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
VESSTDGQVVPQEVLNLPLEKAHEEADDYLDHLLDSLEELSEAHPDCIPDVELSHGVMTLEIPAFGTYVINKQPPNKQIWLASPLSGPNRFDLLNGEWVSLRNGTKLTDILTEEVEKAISKSQ

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 21,038
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 21,032
  3. Avatar for Marvin's bunch 3. Marvin's bunch 52 pts. 20,854
  4. Avatar for Contenders 4. Contenders 36 pts. 20,854
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 20,809
  6. Avatar for Hold My Beer 6. Hold My Beer 16 pts. 20,754
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 20,658
  8. Avatar for VeFold 8. VeFold 6 pts. 20,457
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 4 pts. 20,451
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 20,426
  1. Avatar for Dr.Sillem 61. Dr.Sillem Lv 1 1 pt. 18,995
  2. Avatar for kotenok2000 62. kotenok2000 Lv 1 1 pt. 18,942
  3. Avatar for Wiz kid 63. Wiz kid Lv 1 1 pt. 18,878
  4. Avatar for Larini 64. Larini Lv 1 1 pt. 18,768
  5. Avatar for Mohoernchen 65. Mohoernchen Lv 1 1 pt. 18,703
  6. Avatar for rinze 66. rinze Lv 1 1 pt. 18,692
  7. Avatar for heyubob 67. heyubob Lv 1 1 pt. 18,667
  8. Avatar for B. A. Beder 68. B. A. Beder Lv 1 1 pt. 18,666
  9. Avatar for Swapper242 69. Swapper242 Lv 1 1 pt. 18,652
  10. Avatar for BrittanyBird 70. BrittanyBird Lv 1 1 pt. 18,629

Comments