Icon representing a puzzle

Beginner Puzzle: Staphylococcus Aureus Electron Density

Closed since about 3 years ago

Beginner

Summary

Created
December 01, 2022
Expires
Max points
100
Description

In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 14,761
  2. Avatar for Rechenkraft.net 2. Rechenkraft.net 24 pts. 14,452
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 4 pts. 14,452
  4. Avatar for BBIO WARRIOR 4. BBIO WARRIOR 1 pt. 14,060
  5. Avatar for Tableau ACE 5. Tableau ACE 1 pt. 12,898
  1. Avatar for user939700 11. user939700 Lv 1 57 pts. 14,347
  2. Avatar for EC2020431 12. EC2020431 Lv 1 54 pts. 14,345
  3. Avatar for Head Wolf 13. Head Wolf Lv 1 51 pts. 14,302
  4. Avatar for Bollo 14. Bollo Lv 1 48 pts. 14,272
  5. Avatar for Space Succs 15. Space Succs Lv 1 45 pts. 14,256
  6. Avatar for maeK 16. maeK Lv 1 42 pts. 14,248
  7. Avatar for Ju Young Oh 17. Ju Young Oh Lv 1 39 pts. 14,189
  8. Avatar for s2020369 18. s2020369 Lv 1 37 pts. 14,163
  9. Avatar for krbgs 19. krbgs Lv 1 35 pts. 14,163
  10. Avatar for St. 20. St. Lv 1 32 pts. 14,140

Comments