Icon representing a puzzle

Beginner Puzzle: Staphylococcus Aureus Electron Density

Closed since about 3 years ago

Beginner

Summary

Created
December 01, 2022
Expires
Max points
100
Description

In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 14,761
  2. Avatar for Rechenkraft.net 2. Rechenkraft.net 24 pts. 14,452
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 4 pts. 14,452
  4. Avatar for BBIO WARRIOR 4. BBIO WARRIOR 1 pt. 14,060
  5. Avatar for Tableau ACE 5. Tableau ACE 1 pt. 12,898
  1. Avatar for nicolewong123 31. nicolewong123 Lv 1 15 pts. 14,060
  2. Avatar for aestelle 32. aestelle Lv 1 14 pts. 14,057
  3. Avatar for Cyrelle 33. Cyrelle Lv 1 13 pts. 14,051
  4. Avatar for 2021523 34. 2021523 Lv 1 12 pts. 14,050
  5. Avatar for CFirmalalala 35. CFirmalalala Lv 1 11 pts. 14,044
  6. Avatar for Tina1515 36. Tina1515 Lv 1 10 pts. 14,029
  7. Avatar for katee 37. katee Lv 1 9 pts. 14,022
  8. Avatar for alyssatribaco 38. alyssatribaco Lv 1 8 pts. 14,020
  9. Avatar for tdesa 39. tdesa Lv 1 8 pts. 14,019
  10. Avatar for HANA Y 40. HANA Y Lv 1 7 pts. 14,015

Comments