Icon representing a puzzle

Beginner Puzzle: Staphylococcus Aureus Electron Density

Closed since about 3 years ago

Beginner

Summary

Created
December 01, 2022
Expires
Max points
100
Description

In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 14,761
  2. Avatar for Rechenkraft.net 2. Rechenkraft.net 24 pts. 14,452
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 4 pts. 14,452
  4. Avatar for BBIO WARRIOR 4. BBIO WARRIOR 1 pt. 14,060
  5. Avatar for Tableau ACE 5. Tableau ACE 1 pt. 12,898
  1. Avatar for slashthedragon 21. slashthedragon Lv 1 30 pts. 14,135
  2. Avatar for Cyra_munoz 22. Cyra_munoz Lv 1 28 pts. 14,134
  3. Avatar for Jazza Nova Gonzales 23. Jazza Nova Gonzales Lv 1 26 pts. 14,123
  4. Avatar for Peptide7231 24. Peptide7231 Lv 1 25 pts. 14,108
  5. Avatar for Heysir 25. Heysir Lv 1 23 pts. 14,099
  6. Avatar for KewkieBean01 26. KewkieBean01 Lv 1 21 pts. 14,083
  7. Avatar for Gnny18 27. Gnny18 Lv 1 20 pts. 14,080
  8. Avatar for Dyeri_Geri 28. Dyeri_Geri Lv 1 19 pts. 14,078
  9. Avatar for MARIA ANGELICA S. LEAL 29. MARIA ANGELICA S. LEAL Lv 1 17 pts. 14,064
  10. Avatar for JerryIson_ 30. JerryIson_ Lv 1 16 pts. 14,060

Comments