Icon representing a puzzle

2265: Revisiting Puzzle 68: Bos Taurus

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
February 15, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,750
  2. Avatar for Go Science 2. Go Science 68 pts. 10,722
  3. Avatar for Contenders 3. Contenders 44 pts. 10,623
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 27 pts. 10,599
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 10,597
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,568
  7. Avatar for Australia 7. Australia 5 pts. 10,517
  8. Avatar for OmHS 8. OmHS 3 pts. 10,480
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 10,443
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 10,406
  1. Avatar for heyubob 71. heyubob Lv 1 1 pt. 9,143
  2. Avatar for rinze 72. rinze Lv 1 1 pt. 9,132
  3. Avatar for Mohoernchen 73. Mohoernchen Lv 1 1 pt. 9,107
  4. Avatar for Jackd4w 74. Jackd4w Lv 1 1 pt. 9,081
  5. Avatar for ZAMCF2020 75. ZAMCF2020 Lv 1 1 pt. 9,052
  6. Avatar for Edward814 76. Edward814 Lv 1 1 pt. 9,019
  7. Avatar for Swapper242 77. Swapper242 Lv 1 1 pt. 8,990
  8. Avatar for hi1000 78. hi1000 Lv 1 1 pt. 8,929
  9. Avatar for Mack 79. Mack Lv 1 1 pt. 8,882
  10. Avatar for futsall 80. futsall Lv 1 1 pt. 8,805

Comments