Placeholder image of a protein
Icon representing a puzzle

2300: Electron Density Reconstruction 39

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
May 08, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
GSHMLPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR

Top groups


  1. Avatar for Go Science 100 pts. 15,669
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 15,665
  3. Avatar for Marvin's bunch 3. Marvin's bunch 41 pts. 15,652
  4. Avatar for Contenders 4. Contenders 24 pts. 15,649
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 15,627
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 15,543
  7. Avatar for Australia 7. Australia 4 pts. 15,401
  8. Avatar for BOINC@Poland 8. BOINC@Poland 2 pts. 15,343
  9. Avatar for VeFold 9. VeFold 1 pt. 15,223
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 15,118

  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 23 pts. 15,627
  2. Avatar for phi16 22. phi16 Lv 1 21 pts. 15,618
  3. Avatar for BootsMcGraw 23. BootsMcGraw Lv 1 19 pts. 15,607
  4. Avatar for SemperRabbit 24. SemperRabbit Lv 1 17 pts. 15,598
  5. Avatar for silent gene 25. silent gene Lv 1 16 pts. 15,595
  6. Avatar for Idiotboy 26. Idiotboy Lv 1 15 pts. 15,582
  7. Avatar for Wanderer09 27. Wanderer09 Lv 1 13 pts. 15,560
  8. Avatar for toshiue 28. toshiue Lv 1 12 pts. 15,546
  9. Avatar for christioanchauvin 29. christioanchauvin Lv 1 11 pts. 15,543
  10. Avatar for roarshock 30. roarshock Lv 1 10 pts. 15,529

Comments