Icon representing a puzzle

2308: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
May 31, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,943
  2. Avatar for Go Science 2. Go Science 71 pts. 10,802
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 10,632
  4. Avatar for Contenders 4. Contenders 33 pts. 10,492
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,414
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 10,355
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,285
  8. Avatar for Australia 8. Australia 5 pts. 10,201
  9. Avatar for :) 9. :) 3 pts. 10,190
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,131
  1. Avatar for gmn 11. gmn Lv 1 53 pts. 10,526
  2. Avatar for g_b 12. g_b Lv 1 49 pts. 10,524
  3. Avatar for BootsMcGraw 13. BootsMcGraw Lv 1 46 pts. 10,492
  4. Avatar for phi16 14. phi16 Lv 1 43 pts. 10,473
  5. Avatar for roarshock 15. roarshock Lv 1 40 pts. 10,468
  6. Avatar for akaaka 16. akaaka Lv 1 37 pts. 10,462
  7. Avatar for alcor29 17. alcor29 Lv 1 34 pts. 10,437
  8. Avatar for MicElephant 18. MicElephant Lv 1 32 pts. 10,435
  9. Avatar for dcrwheeler 19. dcrwheeler Lv 1 29 pts. 10,434
  10. Avatar for fpc 20. fpc Lv 1 27 pts. 10,414

Comments