Icon representing a puzzle

2308: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since almost 3 years ago

Novice Overall Prediction

Summary


Created
May 31, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,943
  2. Avatar for Go Science 2. Go Science 71 pts. 10,802
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 10,632
  4. Avatar for Contenders 4. Contenders 33 pts. 10,492
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,414
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 10,355
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,285
  8. Avatar for Australia 8. Australia 5 pts. 10,201
  9. Avatar for :) 9. :) 3 pts. 10,190
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,131

  1. Avatar for Alistair69 51. Alistair69 Lv 1 1 pt. 9,943
  2. Avatar for Dr.Sillem 52. Dr.Sillem Lv 1 1 pt. 9,939
  3. Avatar for Wiz kid 53. Wiz kid Lv 1 1 pt. 9,916
  4. Avatar for alyssa_d_V2.0 54. alyssa_d_V2.0 Lv 1 1 pt. 9,903
  5. Avatar for AlphaFold2 55. AlphaFold2 Lv 1 1 pt. 9,799
  6. Avatar for pizpot 56. pizpot Lv 1 1 pt. 9,788
  7. Avatar for HavocOrder0999 57. HavocOrder0999 Lv 1 1 pt. 9,773
  8. Avatar for carxo 58. carxo Lv 1 1 pt. 9,768
  9. Avatar for Borets 59. Borets Lv 1 1 pt. 9,722
  10. Avatar for BlueEqualsRed 60. BlueEqualsRed Lv 1 1 pt. 9,641

Comments