Icon representing a puzzle

2308: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
May 31, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,943
  2. Avatar for Go Science 2. Go Science 71 pts. 10,802
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 10,632
  4. Avatar for Contenders 4. Contenders 33 pts. 10,492
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,414
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 10,355
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,285
  8. Avatar for Australia 8. Australia 5 pts. 10,201
  9. Avatar for :) 9. :) 3 pts. 10,190
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,131
  1. Avatar for BackBuffer 21. BackBuffer Lv 1 25 pts. 10,397
  2. Avatar for Altercomp 22. Altercomp Lv 1 23 pts. 10,393
  3. Avatar for maithra 23. maithra Lv 1 21 pts. 10,391
  4. Avatar for Idiotboy 24. Idiotboy Lv 1 20 pts. 10,359
  5. Avatar for silent gene 25. silent gene Lv 1 18 pts. 10,357
  6. Avatar for WBarme1234 26. WBarme1234 Lv 1 17 pts. 10,355
  7. Avatar for Bletchley Park 27. Bletchley Park Lv 1 15 pts. 10,340
  8. Avatar for georg137 28. georg137 Lv 1 14 pts. 10,313
  9. Avatar for Flagg65a 29. Flagg65a Lv 1 13 pts. 10,294
  10. Avatar for Skippysk8s 30. Skippysk8s Lv 1 12 pts. 10,285

Comments