Icon representing a puzzle

2308: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
May 31, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,943
  2. Avatar for Go Science 2. Go Science 71 pts. 10,802
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 10,632
  4. Avatar for Contenders 4. Contenders 33 pts. 10,492
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,414
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 10,355
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,285
  8. Avatar for Australia 8. Australia 5 pts. 10,201
  9. Avatar for :) 9. :) 3 pts. 10,190
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,131
  1. Avatar for Wanderer09 31. Wanderer09 Lv 1 11 pts. 10,275
  2. Avatar for Hillbillie 32. Hillbillie Lv 1 10 pts. 10,273
  3. Avatar for pfirth 33. pfirth Lv 1 9 pts. 10,240
  4. Avatar for hansvandenhof 34. hansvandenhof Lv 1 8 pts. 10,239
  5. Avatar for AlkiP0Ps 35. AlkiP0Ps Lv 1 7 pts. 10,201
  6. Avatar for equilibria 36. equilibria Lv 1 7 pts. 10,192
  7. Avatar for machinelves 37. machinelves Lv 1 6 pts. 10,190
  8. Avatar for rezaefar 38. rezaefar Lv 1 5 pts. 10,181
  9. Avatar for Crossed Sticks 39. Crossed Sticks Lv 1 5 pts. 10,165
  10. Avatar for zbp 40. zbp Lv 1 4 pts. 10,158

Comments