Icon representing a puzzle

2308: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
May 31, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,943
  2. Avatar for Go Science 2. Go Science 71 pts. 10,802
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 10,632
  4. Avatar for Contenders 4. Contenders 33 pts. 10,492
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,414
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 10,355
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,285
  8. Avatar for Australia 8. Australia 5 pts. 10,201
  9. Avatar for :) 9. :) 3 pts. 10,190
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,131
  1. Avatar for RichGuilmain 41. RichGuilmain Lv 1 4 pts. 10,146
  2. Avatar for ShadowTactics 42. ShadowTactics Lv 1 4 pts. 10,131
  3. Avatar for ProfVince 43. ProfVince Lv 1 3 pts. 10,128
  4. Avatar for abiogenesis 44. abiogenesis Lv 1 3 pts. 10,061
  5. Avatar for rosie4loop 45. rosie4loop Lv 1 3 pts. 10,052
  6. Avatar for Trajan464 46. Trajan464 Lv 1 2 pts. 10,049
  7. Avatar for heather-1 47. heather-1 Lv 1 2 pts. 10,026
  8. Avatar for Oransche 48. Oransche Lv 1 2 pts. 10,007
  9. Avatar for hada 49. hada Lv 1 2 pts. 9,996
  10. Avatar for Arne Heessels 50. Arne Heessels Lv 1 2 pts. 9,953

Comments