Icon representing a puzzle

2308: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
May 31, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,943
  2. Avatar for Go Science 2. Go Science 71 pts. 10,802
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 10,632
  4. Avatar for Contenders 4. Contenders 33 pts. 10,492
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,414
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 10,355
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,285
  8. Avatar for Australia 8. Australia 5 pts. 10,201
  9. Avatar for :) 9. :) 3 pts. 10,190
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,131
  1. Avatar for DScott 61. DScott Lv 1 1 pt. 9,639
  2. Avatar for Merf 62. Merf Lv 1 1 pt. 9,627
  3. Avatar for rinze 63. rinze Lv 1 1 pt. 9,597
  4. Avatar for Steven Pletsch 64. Steven Pletsch Lv 1 1 pt. 9,548
  5. Avatar for Larini 65. Larini Lv 1 1 pt. 9,521
  6. Avatar for guineapig 66. guineapig Lv 1 1 pt. 9,431
  7. Avatar for mart0258 67. mart0258 Lv 1 1 pt. 9,414
  8. Avatar for fiendish_ghoul 68. fiendish_ghoul Lv 1 1 pt. 9,361
  9. Avatar for pruneau_44 69. pruneau_44 Lv 1 1 pt. 9,347
  10. Avatar for Mohoernchen 70. Mohoernchen Lv 1 1 pt. 9,299

Comments