Icon representing a puzzle

2373: Revisiting Puzzle 113: White Birch

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,898
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,895
  3. Avatar for Contenders 3. Contenders 49 pts. 10,823
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,687
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,679
  6. Avatar for Australia 6. Australia 14 pts. 10,602
  7. Avatar for VeFold 7. VeFold 8 pts. 10,589
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 5 pts. 10,519
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 10,491
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,380
  1. Avatar for BackBuffer 11. BackBuffer Lv 1 56 pts. 10,716
  2. Avatar for BootsMcGraw 12. BootsMcGraw Lv 1 53 pts. 10,711
  3. Avatar for guineapig 13. guineapig Lv 1 50 pts. 10,693
  4. Avatar for gmn 14. gmn Lv 1 47 pts. 10,690
  5. Avatar for christioanchauvin 15. christioanchauvin Lv 1 44 pts. 10,687
  6. Avatar for fpc 16. fpc Lv 1 41 pts. 10,679
  7. Avatar for drumpeter18yrs9yrs 17. drumpeter18yrs9yrs Lv 1 39 pts. 10,646
  8. Avatar for akaaka 18. akaaka Lv 1 36 pts. 10,644
  9. Avatar for Bletchley Park 19. Bletchley Park Lv 1 34 pts. 10,634
  10. Avatar for blazegeek 20. blazegeek Lv 1 32 pts. 10,631

Comments