Icon representing a puzzle

2373: Revisiting Puzzle 113: White Birch

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,898
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,895
  3. Avatar for Contenders 3. Contenders 49 pts. 10,823
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,687
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,679
  6. Avatar for Australia 6. Australia 14 pts. 10,602
  7. Avatar for VeFold 7. VeFold 8 pts. 10,589
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 5 pts. 10,519
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 10,491
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,380
  1. Avatar for abiogenesis 41. abiogenesis Lv 1 6 pts. 10,201
  2. Avatar for DScott 42. DScott Lv 1 6 pts. 10,164
  3. Avatar for heather-1 43. heather-1 Lv 1 5 pts. 10,156
  4. Avatar for JackONeill12 44. JackONeill12 Lv 1 5 pts. 10,130
  5. Avatar for ecali 45. ecali Lv 1 4 pts. 10,108
  6. Avatar for Merf 46. Merf Lv 1 4 pts. 10,066
  7. Avatar for dy9110 47. dy9110 Lv 1 3 pts. 10,043
  8. Avatar for NPrincipi 48. NPrincipi Lv 1 3 pts. 10,032
  9. Avatar for Oransche 49. Oransche Lv 1 3 pts. 10,026
  10. Avatar for Trajan464 50. Trajan464 Lv 1 3 pts. 10,009

Comments