Icon representing a puzzle

2373: Revisiting Puzzle 113: White Birch

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,898
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,895
  3. Avatar for Contenders 3. Contenders 49 pts. 10,823
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,687
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,679
  6. Avatar for Australia 6. Australia 14 pts. 10,602
  7. Avatar for VeFold 7. VeFold 8 pts. 10,589
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 5 pts. 10,519
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 10,491
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,380
  1. Avatar for Pikkachurin 31. Pikkachurin Lv 1 14 pts. 10,480
  2. Avatar for jausmh 32. jausmh Lv 1 13 pts. 10,479
  3. Avatar for cochon 33. cochon Lv 1 12 pts. 10,404
  4. Avatar for rosie4loop 34. rosie4loop Lv 1 11 pts. 10,383
  5. Avatar for ShadowTactics 35. ShadowTactics Lv 1 10 pts. 10,380
  6. Avatar for Opelgang 36. Opelgang Lv 1 9 pts. 10,314
  7. Avatar for alcor29 37. alcor29 Lv 1 9 pts. 10,271
  8. Avatar for SuperEnzyme 38. SuperEnzyme Lv 1 8 pts. 10,253
  9. Avatar for vybi 39. vybi Lv 1 7 pts. 10,239
  10. Avatar for pfirth 40. pfirth Lv 1 7 pts. 10,213

Comments