Icon representing a puzzle

2373: Revisiting Puzzle 113: White Birch

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Go Science 100 pts. 10,898
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,895
  3. Avatar for Contenders 3. Contenders 49 pts. 10,823
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,687
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,679
  6. Avatar for Australia 6. Australia 14 pts. 10,602
  7. Avatar for VeFold 7. VeFold 8 pts. 10,589
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 5 pts. 10,519
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 10,491
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,380

  1. Avatar for Larini 51. Larini Lv 1 2 pts. 9,995
  2. Avatar for Dr.Sillem 52. Dr.Sillem Lv 1 2 pts. 9,980
  3. Avatar for zbp 53. zbp Lv 1 2 pts. 9,977
  4. Avatar for vuvuvu 54. vuvuvu Lv 1 2 pts. 9,955
  5. Avatar for carxo 55. carxo Lv 1 2 pts. 9,942
  6. Avatar for Arne Heessels 56. Arne Heessels Lv 1 1 pt. 9,936
  7. Avatar for Hellcat6 57. Hellcat6 Lv 1 1 pt. 9,927
  8. Avatar for Karlheinz 58. Karlheinz Lv 1 1 pt. 9,884
  9. Avatar for koolcoder101 59. koolcoder101 Lv 1 1 pt. 9,875
  10. Avatar for Steven Pletsch 60. Steven Pletsch Lv 1 1 pt. 9,852

Comments