Icon representing a puzzle

2373: Revisiting Puzzle 113: White Birch

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,898
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,895
  3. Avatar for Contenders 3. Contenders 49 pts. 10,823
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,687
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,679
  6. Avatar for Australia 6. Australia 14 pts. 10,602
  7. Avatar for VeFold 7. VeFold 8 pts. 10,589
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 5 pts. 10,519
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 10,491
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,380
  1. Avatar for pruneau_44 81. pruneau_44 Lv 1 1 pt. 9,085
  2. Avatar for The Nephrons 82. The Nephrons Lv 1 1 pt. 9,060
  3. Avatar for furi0us 83. furi0us Lv 1 1 pt. 9,004
  4. Avatar for Gonegirl 84. Gonegirl Lv 1 1 pt. 8,989
  5. Avatar for Swapper242 85. Swapper242 Lv 1 1 pt. 8,985
  6. Avatar for 122010101049 86. 122010101049 Lv 1 1 pt. 8,917
  7. Avatar for DeDEco 87. DeDEco Lv 1 1 pt. 8,842
  8. Avatar for ElJayski 88. ElJayski Lv 1 1 pt. 8,540
  9. Avatar for jflat06 89. jflat06 Lv 1 1 pt. 7,465
  10. Avatar for Gematron 2874 90. Gematron 2874 Lv 1 1 pt. 5,520

Comments