Icon representing a puzzle

2373: Revisiting Puzzle 113: White Birch

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,898
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,895
  3. Avatar for Contenders 3. Contenders 49 pts. 10,823
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,687
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,679
  6. Avatar for Australia 6. Australia 14 pts. 10,602
  7. Avatar for VeFold 7. VeFold 8 pts. 10,589
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 5 pts. 10,519
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 10,491
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,380
  1. Avatar for hada 61. hada Lv 1 1 pt. 9,823
  2. Avatar for haleyg 62. haleyg Lv 1 1 pt. 9,804
  3. Avatar for AlphaFold2 63. AlphaFold2 Lv 1 1 pt. 9,760
  4. Avatar for Alistair69 64. Alistair69 Lv 1 1 pt. 9,719
  5. Avatar for Yechan Kwon 65. Yechan Kwon Lv 1 1 pt. 9,716
  6. Avatar for rinze 66. rinze Lv 1 1 pt. 9,677
  7. Avatar for MrDKing 67. MrDKing Lv 1 1 pt. 9,606
  8. Avatar for evifnoskcaj 68. evifnoskcaj Lv 1 1 pt. 9,491
  9. Avatar for Helisaf 69. Helisaf Lv 1 1 pt. 9,477
  10. Avatar for jdmclure 70. jdmclure Lv 1 1 pt. 9,468

Comments