Icon representing a puzzle

2373: Revisiting Puzzle 113: White Birch

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,898
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,895
  3. Avatar for Contenders 3. Contenders 49 pts. 10,823
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,687
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,679
  6. Avatar for Australia 6. Australia 14 pts. 10,602
  7. Avatar for VeFold 7. VeFold 8 pts. 10,589
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 5 pts. 10,519
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 10,491
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,380
  1. Avatar for Deleted player 71. Deleted player 1 pt. 9,441
  2. Avatar for Matt57 72. Matt57 Lv 1 1 pt. 9,416
  3. Avatar for Pietro 73. Pietro Lv 1 1 pt. 9,402
  4. Avatar for Mohoernchen 74. Mohoernchen Lv 1 1 pt. 9,382
  5. Avatar for AlexBg 75. AlexBg Lv 1 1 pt. 9,369
  6. Avatar for Nithyashree 76. Nithyashree Lv 1 1 pt. 9,367
  7. Avatar for densva 77. densva Lv 1 1 pt. 9,311
  8. Avatar for Gamercat01 78. Gamercat01 Lv 1 1 pt. 9,285
  9. Avatar for cavmcloone 79. cavmcloone Lv 1 1 pt. 9,172
  10. Avatar for HermanoTastico 80. HermanoTastico Lv 1 1 pt. 9,159

Comments