Icon representing a puzzle

2387: Revisiting Puzzle 124: PDZ Domain

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,071
  2. Avatar for Go Science 2. Go Science 71 pts. 11,053
  3. Avatar for Contenders 3. Contenders 49 pts. 10,835
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,834
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,829
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 10,683
  7. Avatar for Cancer Blasters! 7. Cancer Blasters! 8 pts. 10,648
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 5 pts. 10,635
  9. Avatar for Australia 9. Australia 3 pts. 10,628
  10. Avatar for VeFold 10. VeFold 2 pts. 10,581
  1. Avatar for gmn 21. gmn Lv 1 31 pts. 10,719
  2. Avatar for silent gene 22. silent gene Lv 1 29 pts. 10,696
  3. Avatar for christioanchauvin 23. christioanchauvin Lv 1 27 pts. 10,683
  4. Avatar for Guido 24. Guido Lv 1 25 pts. 10,648
  5. Avatar for WBarme1234 25. WBarme1234 Lv 1 23 pts. 10,635
  6. Avatar for maithra 26. maithra Lv 1 22 pts. 10,632
  7. Avatar for AlkiP0Ps 27. AlkiP0Ps Lv 1 20 pts. 10,628
  8. Avatar for AmphotericinB 28. AmphotericinB Lv 1 19 pts. 10,590
  9. Avatar for Hillbillie 29. Hillbillie Lv 1 18 pts. 10,581
  10. Avatar for Opelgang 30. Opelgang Lv 1 16 pts. 10,573

Comments