Icon representing a puzzle

2387: Revisiting Puzzle 124: PDZ Domain

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,071
  2. Avatar for Go Science 2. Go Science 71 pts. 11,053
  3. Avatar for Contenders 3. Contenders 49 pts. 10,835
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,834
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,829
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 10,683
  7. Avatar for Cancer Blasters! 7. Cancer Blasters! 8 pts. 10,648
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 5 pts. 10,635
  9. Avatar for Australia 9. Australia 3 pts. 10,628
  10. Avatar for VeFold 10. VeFold 2 pts. 10,581
  1. Avatar for georg137 41. georg137 Lv 1 7 pts. 10,325
  2. Avatar for rosie4loop 42. rosie4loop Lv 1 6 pts. 10,310
  3. Avatar for Artoria2e5 43. Artoria2e5 Lv 1 6 pts. 10,260
  4. Avatar for zbp 44. zbp Lv 1 5 pts. 10,251
  5. Avatar for Merf 45. Merf Lv 1 5 pts. 10,243
  6. Avatar for DScott 46. DScott Lv 1 4 pts. 10,190
  7. Avatar for ProfVince 47. ProfVince Lv 1 4 pts. 10,139
  8. Avatar for mibrammall 48. mibrammall Lv 1 4 pts. 10,128
  9. Avatar for Deleted player 49. Deleted player 3 pts. 10,074
  10. Avatar for abiogenesis 50. abiogenesis Lv 1 3 pts. 10,072

Comments