Icon representing a puzzle

2387: Revisiting Puzzle 124: PDZ Domain

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,071
  2. Avatar for Go Science 2. Go Science 71 pts. 11,053
  3. Avatar for Contenders 3. Contenders 49 pts. 10,835
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,834
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,829
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 10,683
  7. Avatar for Cancer Blasters! 7. Cancer Blasters! 8 pts. 10,648
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 5 pts. 10,635
  9. Avatar for Australia 9. Australia 3 pts. 10,628
  10. Avatar for VeFold 10. VeFold 2 pts. 10,581
  1. Avatar for RoflFIN 71. RoflFIN Lv 1 1 pt. 9,558
  2. Avatar for Donobit 72. Donobit Lv 1 1 pt. 9,529
  3. Avatar for notgenious 73. notgenious Lv 1 1 pt. 9,496
  4. Avatar for Mohoernchen 74. Mohoernchen Lv 1 1 pt. 9,490
  5. Avatar for BrittanyBird 75. BrittanyBird Lv 1 1 pt. 9,469
  6. Avatar for KWLEE 76. KWLEE Lv 1 1 pt. 9,451
  7. Avatar for jamiexq 77. jamiexq Lv 1 1 pt. 9,437
  8. Avatar for morlan 78. morlan Lv 1 1 pt. 9,420
  9. Avatar for ProteinGujo 79. ProteinGujo Lv 1 1 pt. 9,399
  10. Avatar for Eunhye 80. Eunhye Lv 1 1 pt. 9,395

Comments