Placeholder image of a protein
Icon representing a puzzle

2397: Electron Density Reconstruction 71

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
December 18, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two very short chains in this one.

Sequence
GIVEQCCTSICSLYQLENYCN FVNQHLCGSHLVEALYLVCGERGFFYTPKT

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,624
  2. Avatar for Go Science 2. Go Science 65 pts. 12,624
  3. Avatar for Contenders 3. Contenders 41 pts. 12,594
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 12,575
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 12,555
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 12,530
  7. Avatar for Australia 7. Australia 4 pts. 12,527
  8. Avatar for VeFold 8. VeFold 2 pts. 12,493
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 12,474
  10. Avatar for METU-BIN 10. METU-BIN 1 pt. 12,339
  1. Avatar for blazegeek 11. blazegeek Lv 1 43 pts. 12,578
  2. Avatar for georg137 12. georg137 Lv 1 39 pts. 12,577
  3. Avatar for christioanchauvin 13. christioanchauvin Lv 1 35 pts. 12,575
  4. Avatar for NinjaGreg 14. NinjaGreg Lv 1 32 pts. 12,573
  5. Avatar for alcor29 15. alcor29 Lv 1 29 pts. 12,561
  6. Avatar for fpc 16. fpc Lv 1 26 pts. 12,555
  7. Avatar for BackBuffer 17. BackBuffer Lv 1 24 pts. 12,553
  8. Avatar for BootsMcGraw 18. BootsMcGraw Lv 1 21 pts. 12,552
  9. Avatar for phi16 19. phi16 Lv 1 19 pts. 12,534
  10. Avatar for WBarme1234 20. WBarme1234 Lv 1 17 pts. 12,530

Comments