Placeholder image of a protein
Icon representing a puzzle

2397: Electron Density Reconstruction 71

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
December 18, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two very short chains in this one.

Sequence
GIVEQCCTSICSLYQLENYCN FVNQHLCGSHLVEALYLVCGERGFFYTPKT

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,624
  2. Avatar for Go Science 2. Go Science 65 pts. 12,624
  3. Avatar for Contenders 3. Contenders 41 pts. 12,594
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 12,575
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 12,555
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 12,530
  7. Avatar for Australia 7. Australia 4 pts. 12,527
  8. Avatar for VeFold 8. VeFold 2 pts. 12,493
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 12,474
  10. Avatar for METU-BIN 10. METU-BIN 1 pt. 12,339
  1. Avatar for Oransche 41. Oransche Lv 1 1 pt. 12,341
  2. Avatar for 2284503 42. 2284503 Lv 1 1 pt. 12,339
  3. Avatar for Artoria2e5 43. Artoria2e5 Lv 1 1 pt. 12,335
  4. Avatar for ShadowTactics 44. ShadowTactics Lv 1 1 pt. 12,335
  5. Avatar for pfirth 45. pfirth Lv 1 1 pt. 12,319
  6. Avatar for Wildcard 34 46. Wildcard 34 Lv 1 1 pt. 12,270
  7. Avatar for Anfinsen_slept_here 47. Anfinsen_slept_here Lv 1 1 pt. 12,231
  8. Avatar for PatrikStar24 48. PatrikStar24 Lv 1 1 pt. 12,230
  9. Avatar for Dr.Sillem 49. Dr.Sillem Lv 1 1 pt. 12,176
  10. Avatar for Merf 50. Merf Lv 1 1 pt. 12,158

Comments