Placeholder image of a protein
Icon representing a puzzle

2397: Electron Density Reconstruction 71

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
December 18, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two very short chains in this one.

Sequence
GIVEQCCTSICSLYQLENYCN FVNQHLCGSHLVEALYLVCGERGFFYTPKT

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,624
  2. Avatar for Go Science 2. Go Science 65 pts. 12,624
  3. Avatar for Contenders 3. Contenders 41 pts. 12,594
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 12,575
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 12,555
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 12,530
  7. Avatar for Australia 7. Australia 4 pts. 12,527
  8. Avatar for VeFold 8. VeFold 2 pts. 12,493
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 12,474
  10. Avatar for METU-BIN 10. METU-BIN 1 pt. 12,339
  1. Avatar for Opelgang 31. Opelgang Lv 1 4 pts. 12,463
  2. Avatar for Hexafluorouranate 32. Hexafluorouranate Lv 1 4 pts. 12,457
  3. Avatar for dcrwheeler 33. dcrwheeler Lv 1 3 pts. 12,454
  4. Avatar for Steven Pletsch 34. Steven Pletsch Lv 1 3 pts. 12,451
  5. Avatar for carsonfb 35. carsonfb Lv 1 3 pts. 12,448
  6. Avatar for Idiotboy 36. Idiotboy Lv 1 2 pts. 12,413
  7. Avatar for kitsoune 37. kitsoune Lv 1 2 pts. 12,384
  8. Avatar for rosie4loop 38. rosie4loop Lv 1 2 pts. 12,373
  9. Avatar for Helisaf 39. Helisaf Lv 1 1 pt. 12,365
  10. Avatar for zbp 40. zbp Lv 1 1 pt. 12,355

Comments