Icon representing a puzzle

2423: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,828
  2. Avatar for Go Science 2. Go Science 70 pts. 9,760
  3. Avatar for Contenders 3. Contenders 47 pts. 9,716
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 9,684
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 9,647
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 9,613
  7. Avatar for Australia 7. Australia 7 pts. 9,602
  8. Avatar for Russian team 8. Russian team 4 pts. 9,527
  9. Avatar for BOINC@Poland 9. BOINC@Poland 2 pts. 9,419
  10. Avatar for VeFold 10. VeFold 1 pt. 9,398
  1. Avatar for christioanchauvin 21. christioanchauvin Lv 1 26 pts. 9,613
  2. Avatar for AlkiP0Ps 22. AlkiP0Ps Lv 1 24 pts. 9,602
  3. Avatar for MicElephant 23. MicElephant Lv 1 22 pts. 9,600
  4. Avatar for silent gene 24. silent gene Lv 1 20 pts. 9,593
  5. Avatar for NPrincipi 25. NPrincipi Lv 1 19 pts. 9,571
  6. Avatar for hansvandenhof 26. hansvandenhof Lv 1 17 pts. 9,566
  7. Avatar for georg137 27. georg137 Lv 1 16 pts. 9,557
  8. Avatar for alcor29 28. alcor29 Lv 1 14 pts. 9,546
  9. Avatar for Gerom 29. Gerom Lv 1 13 pts. 9,527
  10. Avatar for Henery Moe 30. Henery Moe Lv 1 12 pts. 9,507

Comments