Placeholder image of a protein
Icon representing a puzzle

2445: Electron Density Reconstruction 87

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 16, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN TGTTTTTTATAAGA ATCTTATAAAAAAC

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 20,535
  2. Avatar for Go Science 2. Go Science 52 pts. 20,531
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 24 pts. 20,499
  4. Avatar for Contenders 4. Contenders 10 pts. 20,493
  5. Avatar for Marvin's bunch 5. Marvin's bunch 4 pts. 20,350
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 1 pt. 20,337
  7. Avatar for Australia 7. Australia 1 pt. 20,091
  8. Avatar for VeFold 8. VeFold 1 pt. 19,900
  9. Avatar for chemiosmotic 9. chemiosmotic 1 pt. 19,194
  1. Avatar for Merf 41. Merf Lv 1 1 pt. 19,540
  2. Avatar for Vinara 42. Vinara Lv 1 1 pt. 19,540
  3. Avatar for Arne Heessels 43. Arne Heessels Lv 1 1 pt. 19,416
  4. Avatar for nicobul 44. nicobul Lv 1 1 pt. 19,355
  5. Avatar for DScott 45. DScott Lv 1 1 pt. 19,334
  6. Avatar for Mohoernchen 46. Mohoernchen Lv 1 1 pt. 19,313
  7. Avatar for carxo 47. carxo Lv 1 1 pt. 19,252
  8. Avatar for DaedalusJR 48. DaedalusJR Lv 1 1 pt. 19,213
  9. Avatar for Kvaksius 49. Kvaksius Lv 1 1 pt. 19,194
  10. Avatar for Deleted player 50. Deleted player 1 pt. 19,140

Comments