2445: Electron Density Reconstruction 87
Closed since almost 2 years ago
Novice Overall Prediction Electron DensitySummary
- Created
- April 16, 2024
- Expires
- Max points
- 100
The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.
- Sequence
- GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN TGTTTTTTATAAGA ATCTTATAAAAAAC
Top groups
-
100 pts. 20,535
-
-
-
-
-
-
-
-