Placeholder image of a protein
Icon representing a puzzle

2445: Electron Density Reconstruction 87

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
April 16, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN TGTTTTTTATAAGA ATCTTATAAAAAAC

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 20,535
  2. Avatar for Go Science 2. Go Science 52 pts. 20,531
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 24 pts. 20,499
  4. Avatar for Contenders 4. Contenders 10 pts. 20,493
  5. Avatar for Marvin's bunch 5. Marvin's bunch 4 pts. 20,350
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 1 pt. 20,337
  7. Avatar for Australia 7. Australia 1 pt. 20,091
  8. Avatar for VeFold 8. VeFold 1 pt. 19,900
  9. Avatar for chemiosmotic 9. chemiosmotic 1 pt. 19,194

  1. Avatar for jausmh 21. jausmh Lv 1 14 pts. 20,335
  2. Avatar for akaaka 22. akaaka Lv 1 13 pts. 20,252
  3. Avatar for BackBuffer 23. BackBuffer Lv 1 11 pts. 20,239
  4. Avatar for drjr 24. drjr Lv 1 10 pts. 20,227
  5. Avatar for NPrincipi 25. NPrincipi Lv 1 9 pts. 20,222
  6. Avatar for phi16 26. phi16 Lv 1 8 pts. 20,189
  7. Avatar for alcor29 27. alcor29 Lv 1 7 pts. 20,159
  8. Avatar for Steven Pletsch 28. Steven Pletsch Lv 1 6 pts. 20,121
  9. Avatar for AlkiP0Ps 29. AlkiP0Ps Lv 1 5 pts. 20,091
  10. Avatar for rosie4loop 30. rosie4loop Lv 1 4 pts. 20,027

Comments