Placeholder image of a protein
Icon representing a puzzle

2445: Electron Density Reconstruction 87

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 16, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN TGTTTTTTATAAGA ATCTTATAAAAAAC

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 20,535
  2. Avatar for Go Science 2. Go Science 52 pts. 20,531
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 24 pts. 20,499
  4. Avatar for Contenders 4. Contenders 10 pts. 20,493
  5. Avatar for Marvin's bunch 5. Marvin's bunch 4 pts. 20,350
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 1 pt. 20,337
  7. Avatar for Australia 7. Australia 1 pt. 20,091
  8. Avatar for VeFold 8. VeFold 1 pt. 19,900
  9. Avatar for chemiosmotic 9. chemiosmotic 1 pt. 19,194
  1. Avatar for Jenot96 51. Jenot96 Lv 1 1 pt. 19,121
  2. Avatar for pruneau_44 52. pruneau_44 Lv 1 1 pt. 19,070
  3. Avatar for GeorgeTheFurryFrog 53. GeorgeTheFurryFrog Lv 1 1 pt. 19,068
  4. Avatar for rinze 54. rinze Lv 1 1 pt. 19,067
  5. Avatar for silent gene 55. silent gene Lv 1 1 pt. 19,052
  6. Avatar for furi0us 56. furi0us Lv 1 1 pt. 19,040
  7. Avatar for paulcianci 57. paulcianci Lv 1 1 pt. 18,850
  8. Avatar for Alexander78854778 58. Alexander78854778 Lv 1 1 pt. 18,439
  9. Avatar for is_r4el 59. is_r4el Lv 1 1 pt. 14,775
  10. Avatar for Seobi 60. Seobi Lv 1 1 pt. 14,749

Comments