Placeholder image of a protein
Icon representing a puzzle

2481: Electron Density Reconstruction 96

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
June 28, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. You may notice that there’s a base pair in here that doesn’t look normal; it’s a Hoogsteen base pair (as opposed to Watson-Crick). Later on, we’ll ask you to play another version of this puzzle where it’s been put in as Watson-Crick instead of Hoogsteen as we’d like to see which works better. Also, a reminder that DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ACTGTTTACTCTTTAACGTAT ATACGTTAAAGAGTAAACAGT GPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 53,640
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 52 pts. 53,500
  3. Avatar for Contenders 3. Contenders 24 pts. 53,340
  4. Avatar for Go Science 4. Go Science 10 pts. 53,278
  5. Avatar for Marvin's bunch 5. Marvin's bunch 4 pts. 53,241
  6. Avatar for Australia 6. Australia 1 pt. 53,118
  7. Avatar for Void Crushers 7. Void Crushers 1 pt. 52,937
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 52,660
  9. Avatar for VeFold 9. VeFold 1 pt. 51,176
  1. Avatar for grogar7 11. grogar7 Lv 1 39 pts. 53,130
  2. Avatar for AlkiP0Ps 12. AlkiP0Ps Lv 1 35 pts. 53,118
  3. Avatar for dcrwheeler 13. dcrwheeler Lv 1 32 pts. 53,084
  4. Avatar for akaaka 14. akaaka Lv 1 29 pts. 53,083
  5. Avatar for BootsMcGraw 15. BootsMcGraw Lv 1 26 pts. 53,040
  6. Avatar for TheGUmmer 16. TheGUmmer Lv 1 23 pts. 52,937
  7. Avatar for Steven Pletsch 17. Steven Pletsch Lv 1 20 pts. 52,927
  8. Avatar for blazegeek 18. blazegeek Lv 1 18 pts. 52,877
  9. Avatar for Anfinsen_slept_here 19. Anfinsen_slept_here Lv 1 16 pts. 52,682
  10. Avatar for WBarme1234 20. WBarme1234 Lv 1 14 pts. 52,660

Comments

LociOiling Lv 1

To add to the mystery, this week's small molecule puzzle is in fact 2478.

We'll see what happens next week.