Placeholder image of a protein
Icon representing a puzzle

2481: Electron Density Reconstruction 96

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
June 28, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. You may notice that there’s a base pair in here that doesn’t look normal; it’s a Hoogsteen base pair (as opposed to Watson-Crick). Later on, we’ll ask you to play another version of this puzzle where it’s been put in as Watson-Crick instead of Hoogsteen as we’d like to see which works better. Also, a reminder that DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ACTGTTTACTCTTTAACGTAT ATACGTTAAAGAGTAAACAGT GPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 53,640
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 52 pts. 53,500
  3. Avatar for Contenders 3. Contenders 24 pts. 53,340
  4. Avatar for Go Science 4. Go Science 10 pts. 53,278
  5. Avatar for Marvin's bunch 5. Marvin's bunch 4 pts. 53,241
  6. Avatar for Australia 6. Australia 1 pt. 53,118
  7. Avatar for Void Crushers 7. Void Crushers 1 pt. 52,937
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 52,660
  9. Avatar for VeFold 9. VeFold 1 pt. 51,176
  1. Avatar for lilmathew 51. lilmathew Lv 1 1 pt. 49,154
  2. Avatar for furi0us 52. furi0us Lv 1 1 pt. 49,041
  3. Avatar for jpixs 53. jpixs Lv 1 1 pt. 47,999
  4. Avatar for 01010011111 54. 01010011111 Lv 1 1 pt. 22,637
  5. Avatar for CyberGlitch 55. CyberGlitch Lv 1 1 pt. 16,984
  6. Avatar for fatimaezzahra 56. fatimaezzahra Lv 1 1 pt. 16,984
  7. Avatar for Folodi 57. Folodi Lv 1 1 pt. 16,984
  8. Avatar for spvincent 58. spvincent Lv 1 1 pt. 16,984
  9. Avatar for ivalnic 59. ivalnic Lv 1 1 pt. 16,984

Comments

LociOiling Lv 1

To add to the mystery, this week's small molecule puzzle is in fact 2478.

We'll see what happens next week.