Placeholder image of a protein
Icon representing a puzzle

2481: Electron Density Reconstruction 96

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
June 28, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. You may notice that there’s a base pair in here that doesn’t look normal; it’s a Hoogsteen base pair (as opposed to Watson-Crick). Later on, we’ll ask you to play another version of this puzzle where it’s been put in as Watson-Crick instead of Hoogsteen as we’d like to see which works better. Also, a reminder that DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ACTGTTTACTCTTTAACGTAT ATACGTTAAAGAGTAAACAGT GPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 53,640
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 52 pts. 53,500
  3. Avatar for Contenders 3. Contenders 24 pts. 53,340
  4. Avatar for Go Science 4. Go Science 10 pts. 53,278
  5. Avatar for Marvin's bunch 5. Marvin's bunch 4 pts. 53,241
  6. Avatar for Australia 6. Australia 1 pt. 53,118
  7. Avatar for Void Crushers 7. Void Crushers 1 pt. 52,937
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 52,660
  9. Avatar for VeFold 9. VeFold 1 pt. 51,176
  1. Avatar for bentane 41. bentane Lv 1 1 pt. 49,546
  2. Avatar for carxo 42. carxo Lv 1 1 pt. 49,471
  3. Avatar for DiMn0 43. DiMn0 Lv 1 1 pt. 49,447
  4. Avatar for DScott 44. DScott Lv 1 1 pt. 49,392
  5. Avatar for evifnoskcaj 45. evifnoskcaj Lv 1 1 pt. 49,379
  6. Avatar for hansvandenhof 46. hansvandenhof Lv 1 1 pt. 49,371
  7. Avatar for rinze 47. rinze Lv 1 1 pt. 49,357
  8. Avatar for Philosoraptor1 48. Philosoraptor1 Lv 1 1 pt. 49,308
  9. Avatar for osc 49. osc Lv 1 1 pt. 49,228
  10. Avatar for Kimdonghyeon 50. Kimdonghyeon Lv 1 1 pt. 49,210

Comments

LociOiling Lv 1

To add to the mystery, this week's small molecule puzzle is in fact 2478.

We'll see what happens next week.