Placeholder image of a protein
Icon representing a puzzle

2481: Electron Density Reconstruction 96

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
June 28, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. You may notice that there’s a base pair in here that doesn’t look normal; it’s a Hoogsteen base pair (as opposed to Watson-Crick). Later on, we’ll ask you to play another version of this puzzle where it’s been put in as Watson-Crick instead of Hoogsteen as we’d like to see which works better. Also, a reminder that DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ACTGTTTACTCTTTAACGTAT ATACGTTAAAGAGTAAACAGT GPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 53,640
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 52 pts. 53,500
  3. Avatar for Contenders 3. Contenders 24 pts. 53,340
  4. Avatar for Go Science 4. Go Science 10 pts. 53,278
  5. Avatar for Marvin's bunch 5. Marvin's bunch 4 pts. 53,241
  6. Avatar for Australia 6. Australia 1 pt. 53,118
  7. Avatar for Void Crushers 7. Void Crushers 1 pt. 52,937
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 52,660
  9. Avatar for VeFold 9. VeFold 1 pt. 51,176
  1. Avatar for Th1sN@me!sN0tAPun 31. Th1sN@me!sN0tAPun Lv 1 3 pts. 51,503
  2. Avatar for Larini 32. Larini Lv 1 3 pts. 51,464
  3. Avatar for nicobul 33. nicobul Lv 1 2 pts. 51,324
  4. Avatar for pfirth 34. pfirth Lv 1 2 pts. 51,221
  5. Avatar for BarrySampson 35. BarrySampson Lv 1 2 pts. 51,176
  6. Avatar for hada 36. hada Lv 1 1 pt. 51,106
  7. Avatar for Dr.Sillem 37. Dr.Sillem Lv 1 1 pt. 50,887
  8. Avatar for SRob25 38. SRob25 Lv 1 1 pt. 50,491
  9. Avatar for Merf 39. Merf Lv 1 1 pt. 50,417
  10. Avatar for abiogenesis 40. abiogenesis Lv 1 1 pt. 49,650

Comments

LociOiling Lv 1

To add to the mystery, this week's small molecule puzzle is in fact 2478.

We'll see what happens next week.