Placeholder image of a protein
Icon representing a puzzle

2484: Electron Density Reconstruction 98

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
July 17, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. For this first round of this puzzle, we won't have the Refine Density tool active. There are a few chunks of segments on this puzzle that are missing.

Sequence
GPMPGKKFVARVEEILHDPGRTAPVARVKFEDGTKRVVIIPKGIKVGDVVEVKKV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 13,202
  2. Avatar for Go Science 2. Go Science 68 pts. 13,201
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 13,199
  4. Avatar for Void Crushers 4. Void Crushers 27 pts. 13,188
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 13,184
  6. Avatar for Australia 6. Australia 9 pts. 13,181
  7. Avatar for VeFold 7. VeFold 5 pts. 13,165
  8. Avatar for Contenders 8. Contenders 3 pts. 13,156
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 13,094
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 13,050
  1. Avatar for Aubade01 21. Aubade01 Lv 1 18 pts. 13,135
  2. Avatar for rosie4loop 22. rosie4loop Lv 1 16 pts. 13,098
  3. Avatar for manu8170 23. manu8170 Lv 1 15 pts. 13,098
  4. Avatar for WBarme1234 24. WBarme1234 Lv 1 13 pts. 13,094
  5. Avatar for Idiotboy 25. Idiotboy Lv 1 12 pts. 13,093
  6. Avatar for nicobul 26. nicobul Lv 1 11 pts. 13,079
  7. Avatar for maithra 27. maithra Lv 1 9 pts. 13,077
  8. Avatar for spvincent 28. spvincent Lv 1 8 pts. 13,070
  9. Avatar for Anfinsen_slept_here 29. Anfinsen_slept_here Lv 1 8 pts. 13,061
  10. Avatar for Th1sN@me!sN0tAPun 30. Th1sN@me!sN0tAPun Lv 1 7 pts. 13,052

Comments