Placeholder image of a protein
Icon representing a puzzle

2484: Electron Density Reconstruction 98

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
July 17, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. For this first round of this puzzle, we won't have the Refine Density tool active. There are a few chunks of segments on this puzzle that are missing.

Sequence
GPMPGKKFVARVEEILHDPGRTAPVARVKFEDGTKRVVIIPKGIKVGDVVEVKKV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 13,202
  2. Avatar for Go Science 2. Go Science 68 pts. 13,201
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 13,199
  4. Avatar for Void Crushers 4. Void Crushers 27 pts. 13,188
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 13,184
  6. Avatar for Australia 6. Australia 9 pts. 13,181
  7. Avatar for VeFold 7. VeFold 5 pts. 13,165
  8. Avatar for Contenders 8. Contenders 3 pts. 13,156
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 13,094
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 13,050
  1. Avatar for dizzywings 31. dizzywings Lv 1 6 pts. 13,050
  2. Avatar for hada 32. hada Lv 1 5 pts. 13,046
  3. Avatar for jausmh 33. jausmh Lv 1 5 pts. 13,025
  4. Avatar for Ikuso 34. Ikuso Lv 1 4 pts. 13,003
  5. Avatar for zbp 35. zbp Lv 1 4 pts. 13,000
  6. Avatar for Trajan464 36. Trajan464 Lv 1 3 pts. 12,972
  7. Avatar for Alistair69 37. Alistair69 Lv 1 3 pts. 12,968
  8. Avatar for Larini 38. Larini Lv 1 2 pts. 12,962
  9. Avatar for mwm64 39. mwm64 Lv 1 2 pts. 12,920
  10. Avatar for pfirth 40. pfirth Lv 1 2 pts. 12,889

Comments