Placeholder image of a protein
Icon representing a puzzle

2484: Electron Density Reconstruction 98

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
July 17, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. For this first round of this puzzle, we won't have the Refine Density tool active. There are a few chunks of segments on this puzzle that are missing.

Sequence
GPMPGKKFVARVEEILHDPGRTAPVARVKFEDGTKRVVIIPKGIKVGDVVEVKKV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 13,202
  2. Avatar for Go Science 2. Go Science 68 pts. 13,201
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 13,199
  4. Avatar for Void Crushers 4. Void Crushers 27 pts. 13,188
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 13,184
  6. Avatar for Australia 6. Australia 9 pts. 13,181
  7. Avatar for VeFold 7. VeFold 5 pts. 13,165
  8. Avatar for Contenders 8. Contenders 3 pts. 13,156
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 13,094
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 13,050
  1. Avatar for crawforda 51. crawforda Lv 1 1 pt. 12,800
  2. Avatar for osc 52. osc Lv 1 1 pt. 12,782
  3. Avatar for Kimdonghyeon 53. Kimdonghyeon Lv 1 1 pt. 12,770
  4. Avatar for DScott 54. DScott Lv 1 1 pt. 12,768
  5. Avatar for Havenazaki 55. Havenazaki Lv 1 1 pt. 12,701
  6. Avatar for Swapper242 56. Swapper242 Lv 1 1 pt. 12,678
  7. Avatar for danekane 57. danekane Lv 1 1 pt. 12,677
  8. Avatar for tkachenko08 58. tkachenko08 Lv 1 1 pt. 12,673
  9. Avatar for furi0us 59. furi0us Lv 1 1 pt. 12,656
  10. Avatar for Sammy3c2b1a0 60. Sammy3c2b1a0 Lv 1 1 pt. 12,645

Comments