Placeholder image of a protein
Icon representing a puzzle

2484: Electron Density Reconstruction 98

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
July 17, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. For this first round of this puzzle, we won't have the Refine Density tool active. There are a few chunks of segments on this puzzle that are missing.

Sequence
GPMPGKKFVARVEEILHDPGRTAPVARVKFEDGTKRVVIIPKGIKVGDVVEVKKV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 13,202
  2. Avatar for Go Science 2. Go Science 68 pts. 13,201
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 13,199
  4. Avatar for Void Crushers 4. Void Crushers 27 pts. 13,188
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 13,184
  6. Avatar for Australia 6. Australia 9 pts. 13,181
  7. Avatar for VeFold 7. VeFold 5 pts. 13,165
  8. Avatar for Contenders 8. Contenders 3 pts. 13,156
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 13,094
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 13,050
  1. Avatar for Tian00 41. Tian00 Lv 1 2 pts. 12,885
  2. Avatar for Dr.Sillem 42. Dr.Sillem Lv 1 1 pt. 12,864
  3. Avatar for rinze 43. rinze Lv 1 1 pt. 12,856
  4. Avatar for Merf 44. Merf Lv 1 1 pt. 12,854
  5. Avatar for KRUK94 45. KRUK94 Lv 1 1 pt. 12,850
  6. Avatar for carxo 46. carxo Lv 1 1 pt. 12,831
  7. Avatar for zo3xiaJonWeinberg 47. zo3xiaJonWeinberg Lv 1 1 pt. 12,827
  8. Avatar for Mohoernchen 48. Mohoernchen Lv 1 1 pt. 12,826
  9. Avatar for alkali_menace 49. alkali_menace Lv 1 1 pt. 12,817
  10. Avatar for abiogenesis 50. abiogenesis Lv 1 1 pt. 12,806

Comments