Icon representing a puzzle

2513: Revisiting Puzzle 73: Polycystein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
September 25, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,746
  2. Avatar for Go Science 2. Go Science 68 pts. 10,677
  3. Avatar for Void Crushers 3. Void Crushers 44 pts. 10,571
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 10,484
  5. Avatar for Contenders 5. Contenders 16 pts. 10,481
  6. Avatar for Australia 6. Australia 9 pts. 10,429
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 10,371
  8. Avatar for VeFold 8. VeFold 3 pts. 10,101
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 9,966
  10. Avatar for Russian team 10. Russian team 1 pt. 9,599
  1. Avatar for christioanchauvin 11. christioanchauvin Lv 1 47 pts. 10,484
  2. Avatar for BootsMcGraw 12. BootsMcGraw Lv 1 44 pts. 10,481
  3. Avatar for Galaxie 13. Galaxie Lv 1 40 pts. 10,431
  4. Avatar for AlkiP0Ps 14. AlkiP0Ps Lv 1 37 pts. 10,429
  5. Avatar for g_b 15. g_b Lv 1 34 pts. 10,417
  6. Avatar for NinjaGreg 16. NinjaGreg Lv 1 31 pts. 10,412
  7. Avatar for Punzi Baker 3 17. Punzi Baker 3 Lv 1 28 pts. 10,377
  8. Avatar for fpc 18. fpc Lv 1 26 pts. 10,371
  9. Avatar for Bletchley Park 19. Bletchley Park Lv 1 24 pts. 10,285
  10. Avatar for drumpeter18yrs9yrs 20. drumpeter18yrs9yrs Lv 1 22 pts. 10,234

Comments