Icon representing a puzzle

2513: Revisiting Puzzle 73: Polycystein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
September 25, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,746
  2. Avatar for Go Science 2. Go Science 68 pts. 10,677
  3. Avatar for Void Crushers 3. Void Crushers 44 pts. 10,571
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 10,484
  5. Avatar for Contenders 5. Contenders 16 pts. 10,481
  6. Avatar for Australia 6. Australia 9 pts. 10,429
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 10,371
  8. Avatar for VeFold 8. VeFold 3 pts. 10,101
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 9,966
  10. Avatar for Russian team 10. Russian team 1 pt. 9,599
  1. Avatar for DScott 51. DScott Lv 1 1 pt. 9,219
  2. Avatar for zbp 52. zbp Lv 1 1 pt. 9,218
  3. Avatar for abiogenesis 53. abiogenesis Lv 1 1 pt. 9,213
  4. Avatar for Th1sN@me!sN0tAPun 54. Th1sN@me!sN0tAPun Lv 1 1 pt. 9,169
  5. Avatar for Larini 55. Larini Lv 1 1 pt. 9,112
  6. Avatar for Merf 56. Merf Lv 1 1 pt. 9,100
  7. Avatar for rinze 57. rinze Lv 1 1 pt. 9,027
  8. Avatar for mengzach 58. mengzach Lv 1 1 pt. 8,935
  9. Avatar for nancy_naniewoo 59. nancy_naniewoo Lv 1 1 pt. 8,754
  10. Avatar for Jenot96 60. Jenot96 Lv 1 1 pt. 8,626

Comments