Icon representing a puzzle

2513: Revisiting Puzzle 73: Polycystein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
September 25, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,746
  2. Avatar for Go Science 2. Go Science 68 pts. 10,677
  3. Avatar for Void Crushers 3. Void Crushers 44 pts. 10,571
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 10,484
  5. Avatar for Contenders 5. Contenders 16 pts. 10,481
  6. Avatar for Australia 6. Australia 9 pts. 10,429
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 10,371
  8. Avatar for VeFold 8. VeFold 3 pts. 10,101
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 9,966
  10. Avatar for Russian team 10. Russian team 1 pt. 9,599
  1. Avatar for Hellcat6 31. Hellcat6 Lv 1 7 pts. 9,846
  2. Avatar for toshiue 32. toshiue Lv 1 6 pts. 9,735
  3. Avatar for jamiexq 33. jamiexq Lv 1 6 pts. 9,733
  4. Avatar for BlueCat74 34. BlueCat74 Lv 1 5 pts. 9,699
  5. Avatar for heather-1 35. heather-1 Lv 1 4 pts. 9,609
  6. Avatar for Gerom 36. Gerom Lv 1 4 pts. 9,599
  7. Avatar for Crossed Sticks 37. Crossed Sticks Lv 1 3 pts. 9,590
  8. Avatar for Trajan464 38. Trajan464 Lv 1 3 pts. 9,551
  9. Avatar for Alistair69 39. Alistair69 Lv 1 3 pts. 9,479
  10. Avatar for turbolag 40. turbolag Lv 1 2 pts. 9,460

Comments