Icon representing a puzzle

2561: Revisiting Puzzle 90: Heliomicin

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
January 15, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,850
  2. Avatar for Go Science 2. Go Science 65 pts. 9,808
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 41 pts. 9,709
  4. Avatar for Contenders 4. Contenders 24 pts. 9,658
  5. Avatar for Australia 5. Australia 14 pts. 9,657
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 9,612
  7. Avatar for VeFold 7. VeFold 4 pts. 9,585
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 9,571
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 9,546
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,501
  1. Avatar for antibot215 61. antibot215 Lv 1 1 pt. 8,193
  2. Avatar for hada 62. hada Lv 1 1 pt. 8,173
  3. Avatar for Narkael 63. Narkael Lv 1 1 pt. 8,171
  4. Avatar for Benote 64. Benote Lv 1 1 pt. 8,062
  5. Avatar for efull 65. efull Lv 1 1 pt. 8,015
  6. Avatar for furi0us 66. furi0us Lv 1 1 pt. 7,858
  7. Avatar for Kimdonghyeon 67. Kimdonghyeon Lv 1 1 pt. 7,773
  8. Avatar for Sammy3c2b1a0 68. Sammy3c2b1a0 Lv 1 1 pt. 7,729
  9. Avatar for ProfVince 69. ProfVince Lv 1 1 pt. 7,369
  10. Avatar for frankgillmore1 70. frankgillmore1 Lv 1 1 pt. 1,833

Comments