Icon representing a puzzle

2561: Revisiting Puzzle 90: Heliomicin

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
January 15, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,850
  2. Avatar for Go Science 2. Go Science 65 pts. 9,808
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 41 pts. 9,709
  4. Avatar for Contenders 4. Contenders 24 pts. 9,658
  5. Avatar for Australia 5. Australia 14 pts. 9,657
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 9,612
  7. Avatar for VeFold 7. VeFold 4 pts. 9,585
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 9,571
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 9,546
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,501
  1. Avatar for TheGUmmer 21. TheGUmmer Lv 1 19 pts. 9,571
  2. Avatar for akaaka 22. akaaka Lv 1 17 pts. 9,557
  3. Avatar for orily1337 23. orily1337 Lv 1 15 pts. 9,546
  4. Avatar for georg137 24. georg137 Lv 1 14 pts. 9,528
  5. Avatar for SaraL 25. SaraL Lv 1 12 pts. 9,501
  6. Avatar for Vinara 26. Vinara Lv 1 11 pts. 9,492
  7. Avatar for JuliaBCollet 27. JuliaBCollet Lv 1 10 pts. 9,486
  8. Avatar for hookedwarm 28. hookedwarm Lv 1 9 pts. 9,484
  9. Avatar for nicobul 29. nicobul Lv 1 8 pts. 9,463
  10. Avatar for Alistair69 30. Alistair69 Lv 1 7 pts. 9,428

Comments