Icon representing a puzzle

2561: Revisiting Puzzle 90: Heliomicin

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
January 15, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,850
  2. Avatar for Go Science 2. Go Science 65 pts. 9,808
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 41 pts. 9,709
  4. Avatar for Contenders 4. Contenders 24 pts. 9,658
  5. Avatar for Australia 5. Australia 14 pts. 9,657
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 9,612
  7. Avatar for VeFold 7. VeFold 4 pts. 9,585
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 9,571
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 9,546
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,501
  1. Avatar for alcor29 31. alcor29 Lv 1 6 pts. 9,424
  2. Avatar for hansvandenhof 32. hansvandenhof Lv 1 6 pts. 9,353
  3. Avatar for jamiexq 33. jamiexq Lv 1 5 pts. 9,330
  4. Avatar for pfirth 34. pfirth Lv 1 4 pts. 9,309
  5. Avatar for heather-1 35. heather-1 Lv 1 4 pts. 9,302
  6. Avatar for Th1sN@me!sN0tAPun 36. Th1sN@me!sN0tAPun Lv 1 3 pts. 9,279
  7. Avatar for Crossed Sticks 37. Crossed Sticks Lv 1 3 pts. 9,173
  8. Avatar for abiogenesis 38. abiogenesis Lv 1 3 pts. 9,153
  9. Avatar for maithra 39. maithra Lv 1 2 pts. 9,149
  10. Avatar for rosie4loop 40. rosie4loop Lv 1 2 pts. 9,038

Comments