Icon representing a puzzle

2578: Revisiting Puzzle 96: Collagen

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
February 26, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,292
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 10,261
  3. Avatar for Void Crushers 3. Void Crushers 44 pts. 10,055
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 9,965
  5. Avatar for Contenders 5. Contenders 16 pts. 9,955
  6. Avatar for Australia 6. Australia 9 pts. 9,896
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 9,870
  8. Avatar for VeFold 8. VeFold 3 pts. 9,844
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 9,146
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,035
  1. Avatar for prkfour 41. prkfour Lv 1 1 pt. 8,862
  2. Avatar for ppp6 42. ppp6 Lv 1 1 pt. 8,862
  3. Avatar for froschi2 43. froschi2 Lv 1 1 pt. 8,834
  4. Avatar for DScott 44. DScott Lv 1 1 pt. 8,806
  5. Avatar for Larini 45. Larini Lv 1 1 pt. 8,770
  6. Avatar for ProteinShake 46. ProteinShake Lv 1 1 pt. 8,766
  7. Avatar for zbp 47. zbp Lv 1 1 pt. 8,667
  8. Avatar for RWoodcock 48. RWoodcock Lv 1 1 pt. 8,624
  9. Avatar for ucad 49. ucad Lv 1 1 pt. 8,611
  10. Avatar for carxo 50. carxo Lv 1 1 pt. 8,607

Comments