Icon representing a puzzle

2578: Revisiting Puzzle 96: Collagen

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
February 26, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,292
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 10,261
  3. Avatar for Void Crushers 3. Void Crushers 44 pts. 10,055
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 9,965
  5. Avatar for Contenders 5. Contenders 16 pts. 9,955
  6. Avatar for Australia 6. Australia 9 pts. 9,896
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 9,870
  8. Avatar for VeFold 8. VeFold 3 pts. 9,844
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 9,146
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,035
  1. Avatar for kitsoune 51. kitsoune Lv 1 1 pt. 8,521
  2. Avatar for haleyg 52. haleyg Lv 1 1 pt. 8,471
  3. Avatar for Merf 53. Merf Lv 1 1 pt. 8,379
  4. Avatar for Mohoernchen 54. Mohoernchen Lv 1 1 pt. 8,350
  5. Avatar for Fasodankfds 55. Fasodankfds Lv 1 1 pt. 8,223
  6. Avatar for AlphaFold2 56. AlphaFold2 Lv 1 1 pt. 8,196
  7. Avatar for melonogaster 57. melonogaster Lv 1 1 pt. 8,177
  8. Avatar for Sadek 58. Sadek Lv 1 1 pt. 8,125
  9. Avatar for Sammy3c2b1a0 59. Sammy3c2b1a0 Lv 1 1 pt. 8,115
  10. Avatar for Kimdonghyeon 60. Kimdonghyeon Lv 1 1 pt. 8,095

Comments