Icon representing a puzzle

2578: Revisiting Puzzle 96: Collagen

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
February 26, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,292
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 10,261
  3. Avatar for Void Crushers 3. Void Crushers 44 pts. 10,055
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 9,965
  5. Avatar for Contenders 5. Contenders 16 pts. 9,955
  6. Avatar for Australia 6. Australia 9 pts. 9,896
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 9,870
  8. Avatar for VeFold 8. VeFold 3 pts. 9,844
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 9,146
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,035
  1. Avatar for jamiexq 21. jamiexq Lv 1 15 pts. 9,684
  2. Avatar for alcor29 22. alcor29 Lv 1 14 pts. 9,682
  3. Avatar for pfirth 23. pfirth Lv 1 12 pts. 9,659
  4. Avatar for Th1sN@me!sN0tAPun 24. Th1sN@me!sN0tAPun Lv 1 11 pts. 9,646
  5. Avatar for heather-1 25. heather-1 Lv 1 10 pts. 9,603
  6. Avatar for georg137 26. georg137 Lv 1 8 pts. 9,598
  7. Avatar for Crossed Sticks 27. Crossed Sticks Lv 1 7 pts. 9,445
  8. Avatar for JuliaBCollet 28. JuliaBCollet Lv 1 7 pts. 9,419
  9. Avatar for Hellcat6 29. Hellcat6 Lv 1 6 pts. 9,377
  10. Avatar for hansvandenhof 30. hansvandenhof Lv 1 5 pts. 9,265

Comments