Icon representing a puzzle

2671: Revisiting Puzzle 52: Bacteria Energy

Closed since 5 months ago

Novice Overall Prediction

Summary

Created
October 08, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,687
  2. Avatar for Go Science 2. Go Science 70 pts. 11,647
  3. Avatar for FamilyBarmettler 3. FamilyBarmettler 47 pts. 11,579
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 11,418
  5. Avatar for Void Crushers 5. Void Crushers 19 pts. 11,339
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 11,333
  7. Avatar for Contenders 7. Contenders 7 pts. 11,282
  8. Avatar for Australia 8. Australia 4 pts. 11,269
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 11,046
  10. Avatar for SETI.Germany 10. SETI.Germany 1 pt. 10,974
  1. Avatar for Jenot96 61. Jenot96 Lv 1 1 pt. 9,955
  2. Avatar for efull 62. efull Lv 1 1 pt. 9,928
  3. Avatar for Merf 63. Merf Lv 1 1 pt. 9,921
  4. Avatar for lalit 64. lalit Lv 1 1 pt. 9,920
  5. Avatar for tigerlucifer 65. tigerlucifer Lv 1 1 pt. 9,908
  6. Avatar for LHOr 66. LHOr Lv 1 1 pt. 9,904
  7. Avatar for RWoodcock 67. RWoodcock Lv 1 1 pt. 9,882
  8. Avatar for blindsniper 68. blindsniper Lv 1 1 pt. 9,869
  9. Avatar for Kimdonghyeon 69. Kimdonghyeon Lv 1 1 pt. 9,852
  10. Avatar for corsierosie 70. corsierosie Lv 1 1 pt. 9,837

Comments