Icon representing a puzzle

2671: Revisiting Puzzle 52: Bacteria Energy

Closed since 5 months ago

Novice Overall Prediction

Summary

Created
October 08, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,687
  2. Avatar for Go Science 2. Go Science 70 pts. 11,647
  3. Avatar for FamilyBarmettler 3. FamilyBarmettler 47 pts. 11,579
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 11,418
  5. Avatar for Void Crushers 5. Void Crushers 19 pts. 11,339
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 11,333
  7. Avatar for Contenders 7. Contenders 7 pts. 11,282
  8. Avatar for Australia 8. Australia 4 pts. 11,269
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 11,046
  10. Avatar for SETI.Germany 10. SETI.Germany 1 pt. 10,974
  1. Avatar for hookedwarm 71. hookedwarm Lv 1 1 pt. 9,720
  2. Avatar for antibot215 72. antibot215 Lv 1 1 pt. 9,647
  3. Avatar for Hellcat6 73. Hellcat6 Lv 1 1 pt. 9,586
  4. Avatar for drjr 74. drjr Lv 1 1 pt. 8,417
  5. Avatar for neare2330 75. neare2330 Lv 1 1 pt. 1,913
  6. Avatar for rmoretti 76. rmoretti Lv 1 1 pt. 0
  7. Avatar for names7332 77. names7332 Lv 1 1 pt. 0
  8. Avatar for Bletchley Park 78. Bletchley Park Lv 1 1 pt. 0
  9. Avatar for Sciren 79. Sciren Lv 1 1 pt. 0
  10. Avatar for DeShl5452 80. DeShl5452 Lv 1 1 pt. 0

Comments