Placeholder image of a protein
Icon representing a puzzle

1393: Unsolved De-novo Freestyle 107

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 20, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EKDEKIMEEMKKLVEQVKKKGGRVRITIRKENGTVRIRVEVDVDGHDTTVEWEGGSDDVMEHVKQQLQEVKDQHN

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,445
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 9,430
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 9,393
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 9,390
  5. Avatar for Go Science 5. Go Science 27 pts. 9,372
  6. Avatar for Contenders 6. Contenders 18 pts. 9,369
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,347
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,300
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 5 pts. 9,292
  10. Avatar for xkcd 10. xkcd 3 pts. 9,225
  1. Avatar for Susume 11. Susume Lv 1 71 pts. 9,371
  2. Avatar for reefyrob 12. reefyrob Lv 1 68 pts. 9,358
  3. Avatar for ZeroLeak7 13. ZeroLeak7 Lv 1 66 pts. 9,353
  4. Avatar for grogar7 14. grogar7 Lv 1 64 pts. 9,339
  5. Avatar for eusair 15. eusair Lv 1 61 pts. 9,335
  6. Avatar for caglar 16. caglar Lv 1 59 pts. 9,334
  7. Avatar for Blipperman 17. Blipperman Lv 1 57 pts. 9,329
  8. Avatar for phi16 18. phi16 Lv 1 55 pts. 9,319
  9. Avatar for crpainter 19. crpainter Lv 1 53 pts. 9,317
  10. Avatar for Deleted player 20. Deleted player pts. 9,316

Comments